PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Seita.4G012400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRF
Protein Properties Length: 482aa    MW: 51646.3 Da    PI: 9.6632
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Seita.4G012400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.82.3e-24230274145
                 WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                         d+ep+rCrRtDGKkWRCs+++ +++k+CErH+hrgr+rsrk++e+
  Seita.4G012400.1.p 230 DPEPWRCRRTDGKKWRCSKEAHPDSKYCERHMHRGRNRSRKPVES 274
                         79****************************************986 PP

2QLQ61.32.7e-21156190236
                 QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiq 36 
                          FTaaQ+++L++Q+l+yKyL+a++PvPp+Ll++++
  Seita.4G012400.1.p 156 VFTAAQWAELEQQALIYKYLMAGVPVPPDLLLPVR 190
                         5********************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009512.5E-11155191IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166623.07156191IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.3E-15157190IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166726.346230274IPR014977WRC domain
PfamPF088796.2E-21231273IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 482 aa     Download sequence    Send to blast
GGRAAPRAVQ DRAADSGAGE HHRIAIASKA NPSETKAATP SYLQIPHHLH RLLPSSPSSI  60
NGRHQEPSNP HLTSPPASSS AVRFPRLLSV RSFLVLVGLK EEGKGEVGDW GWSEAVGARP  120
SMLSSASSAG AAAGDGGWGW AVGGGGYPPP QRGAAVFTAA QWAELEQQAL IYKYLMAGVP  180
VPPDLLLPVR PSPHSAAAAF SFAGPAATSP FYHHHHPSLS YYAYYGKKLD PEPWRCRRTD  240
GKKWRCSKEA HPDSKYCERH MHRGRNRSRK PVESKTASPA HPSQPQLSTV TTTTRETAPL  300
DSLTAGGKTH GLSLGGAGSS QLHVDASNAH YRYGSKYPLG AKADAGELSF FSGASGNSRG  360
FTIDSPTDNS WNSLPSNVPP FTLSKSRDSG LLPGTYSYSQ LETPQELGQV TIASLSQEQE  420
RHSFSSGAGG LLGNVKQENQ PLRPFFDEWP GTRDSWSEMD DARSNRTSFS TTQLSISIPM  480
PR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004964364.10.0PREDICTED: growth-regulating factor 5-like isoform X1
SwissprotQ6AWY40.0GRF5_ORYSJ; Growth-regulating factor 5
TrEMBLK3Y3N10.0K3Y3N1_SETIT; Uncharacterized protein
STRINGSi008818m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP110462431
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.11e-22growth-regulating factor 5